Protéines recombinantes
Protéines modifiées ou manipulées codées par l'ADN recombinant et adaptées à divers usages, notamment la modification de séquences génétiques, la production massive de protéines et la fabrication de produits commerciaux.
Conjugué
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (19)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (35,430)
À utiliser avec (application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,034)
- (3)
- (2)
- (7)
- (21,443)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (157)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,399)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,872)
- (175)
- (8)
- (1)
- (31)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,023)
- (160)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,227)
- (1)
- (157)
- (18)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (195)
- (378)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,735)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (3,148)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (34,595)
Forme
- (1)
- (23,203)
- (5,448)
- (29)
- (146)
- (26)
- (35)
Espèces
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (489)
- (1)
- (1)
- (1)
- (27,026)
- (1)
- (1)
- (22)
- (1)
- (837)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (123)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
Rechercher dans les résultats
Recherche par mot-clé:
Effacer la recherche
1
–
15
de
32,082
résultats
| Séquence | RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human FAM18B (aa 173-205) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | VVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYGGWIVDNCPIVKELWMALIKKGIIPDLVIYLSDTENNGK |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human Adenylate Kinase 9 (aa 581-668) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human C1orf167 (aa 1031-1101) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | SVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQH |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SOBP (aa 123-206) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | KAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYIEVTEEGT |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | 0.5 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SERPINB7 (aa 203-334) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human PHOX2B (aa 268-302) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human BCL6B (aa 117-156) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SPAG4 (aa 191-279) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human TMEM132A (aa 642-742) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human HEXB (aa 106-166) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | ELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSV |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human NAPE PLD (aa 103-196) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLL |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SAMD9L (aa 306-402) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | SKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTG |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human PEO1 (aa 143-277) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human p70 S6 Kinase (aa 446-516) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Séquence | GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR |
|---|---|
| Grade de qualité ou de pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Statut réglementaire | RUO |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human DDB2 (aa 43-182) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |