Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Forme
- (1)
- (1)
- (23,200)
- (5,038)
- (29)
- (22)
- (26)
- (35)
À utiliser avec (application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (93)
- (785)
- (3)
Recombinant
- (69)
- (28,215)
Conjugué
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
Espèces
- (2)
- (4)
- (29)
- (2)
- (1)
- (256)
- (23,138)
- (1)
Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
Recherche par mot-clé:
Effacer la recherche
1
–
15
de
24,466
résultats
| État réglementaire | RUO |
|---|---|
| Séquence | PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human COL9A1 (aa 205-277) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human DENND1B (aa 617-697) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | FPRFLKSEIYKKLVNSQQVPNHK |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human RGS21 (aa 124-146) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SFT2D2 (aa 1-33) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human CCDC19 (aa 34-116) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| Plage de pH | 7.4 |
|---|---|
| Numéro d’adhésion | Q8NFQ8 |
| Séquence | SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
| Type de produit | Protein |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Nom | Human TOR1AIP2 (aa 3-63) Control Fragment |
| Marqueur de protéine | His-ABP-tag |
| À utiliser avec (application) | Neutralization,Control |
| Forme | Liquid |
| Nom usuel | TOR1AIP2 |
| État réglementaire | RUO |
| Conditions de stockage | -20°C, Avoid Freeze/Thaw Cycles |
| Identification génétique (Entrez) | 163590 |
| Système d’expression | E. coli |
| Méthode de purification | Purified |
| Symbole de gène(s) | TOR1AIP2 |
| Formule | PBS, 1M urea with no preservative; pH 7.4 |
| Alias de gène | 1110020D10Rik; 15 kDa interferon-responsive protein; 15kDa; A130072J07; AA103493; AW060462; AW610675; C77739; Ifrg15; interferon alpha responsive gene, 15 kDa; interferon alpha responsive protein (15 kDa); interferon alpha responsive protein; torsin-1A-interacting protein 2; interferon responsive gene 15; Lull1; lumenal domain like LAP1; lumenal domain-like LAP1; NET9; RP11-12M5.5; TOR1AIP2; torsin 1A interacting protein 2; torsin A interacting protein 2; torsin-1A-interacting protein 2; Torsin-1A-interacting protein 2, isoform IFRG15 |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | LEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYP |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human TTC4 (aa 188-283) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | AQSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALTPAFLVCVGSSPFCKNFLRGRKVYQI |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human TTC4 (aa 286-386) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human CBWD1 (aa 80-113) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human CYB5RL (aa 254-315) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | PFSIEHILSSLPERSLPARAACPPQPAGRQSPAKPEEP |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human GSC2 (aa 19-56) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | QRSSEFCGLGAEFSQNLNFVPSQRVSQIEHFYKPDTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNHI |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human ZNF606 (aa 207-301) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human NOXRED1 (aa 231-333) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human DRGX (aa 187-263) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human Vinculin (aa 173-321) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |