missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP100905

Invitrogen™ Human TMEM132A (aa 642-742) Control Fragment Recombinant Protein

Catalog No. RP100905
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100905 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100905 Supplier Invitrogen™ Supplier No. RP100905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62524 (PA5-62524. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

Accession Number Q24JP5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54972
Name Human TMEM132A (aa 642-742) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6720481D13Rik; GBP; glucose-regulated protein, 78 kDa; GRP78 binding protein; GRP78-binding protein; heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa) binding protein 1; heat shock 70 kDa protein 5 binding protein 1; heat shock protein 5 binding protein 1; HSPA5-binding protein 1; Hspa5bp1; KIAA1583; LOW QUALITY PROTEIN: transmembrane protein 132 A; Orai1; R74613; TMEM132A; Transmembrane protein 132 A
Common Name TMEM132A
Gene Symbol TMEM132A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less