missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human p70 S6 Kinase (aa 446-516) Control Fragment Recombinant Protein

Numéro de catalogue. RP102872
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP102872 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP102872 Fournisseur Invitrogen™ Code fournisseur RP102872

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83463 (PA5-83463. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KB1 (p70S6K) is a serine/threonine kinase with 2 non-identical kinase catalytic domains which phosphorylates several residues of the S6 ribosomal protein. p70 S6 kinase is predominantly localized in the cytoplasm, and is essential in growth factors regulated cell proliferation, pathways involving cell motility, such as metastases, the immune response, and tissue repair. p70 S6 kinase acts downstream of phosphoinositide (PI) 3-kinase, and its main physiological target is the S6 ribosomal protein, which is involved in upregulation of protein synthesis. The kinase activity of p70 S6 kinase leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding p70 S6 kinase and overexpression are seen in some breast cancer cell lines.

Spécifications

Numéro d'enregistrement P23443
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 6198
Nom Human p70 S6 Kinase (aa 446-516) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène 10539; 2610318I15Rik; 4732464A07Rik; 70 kDa ribosomal protein S6 kinase 1; 7084; 70 kDa; 7-10; AA959758; AI256796; AI314060; CG10539; CG10539-PA; CG10539-PB; Dmel\CG10539; Dmel_CG10539; Dp70[s6k]; Dp70S6k; dps6k; dS6 kinase; dS6K; d-S6K; dS6K1; EC 2.7.11.1; fs(3)07084; hypothetical protein; kinase p70S6K; KS6B1; l(3)07084; p70 p70-S6K; p70 ribosomal S6 kinase; p70 ribosomal S6 kinase alpha; p70 S6 kinase; p70 S6 kinase 1; p70 S6 kinase alpha; p70 S6 kinase, alpha; p70 S6K; p70 S6KA; p70 S6K-alpha; p70(S6K)-alpha; p70/85s6k; p70/S6K; p70[S6 kinase]; p70[S6k]; p70[S6kinase]; p70-alpha; p70S6 kinase; p70S6k; p70-S6K; p70-S6K 1; p70S6K kinase; p70s6k protein kinase homolog; P70S6K1; p70S6K-alpha; p80-S6K 1; p85 p85S6K; Pk.?6; Pk64F; protein kinase-like 64 F; PS6K; p-S6K; ribosomal protein S6 kinase; ribosomal protein S6 kinase B1; ribosomal protein S6 kinase beta-1; Ribosomal protein S6 kinase I; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 70 kD, polypeptide 1; ribosomal protein S6 kinase, 70 kDa, polypeptide 1; ribosomal protein S6 kinase, polypeptide 1; ribosomal S6 protein kinase; Rps6kb1; RPS6-p70-protein kinase; S6 K; S6 kinase; s6k; S6K kinase; S6K1; s6k11; S6K-beta-1; S6kinase; S6-kinase; S6k-PA; S6k-PB; serine/threonine kinase 14 alpha; serine/threonine-protein kinase 14 A; STK14A
Nom usuel p70 S6 Kinase
Symbole de gène RPS6KB1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats