missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NAPE PLD (aa 103-196) Control Fragment Recombinant Protein

Catalog No. RP92785
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92785 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92785 Supplier Invitrogen™ Supplier No. RP92785

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55055 (PA5-55055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-Acylphosphatidylethanolamine (NAPE)-hydrolyzing phospholipase D (NAPE-PLD) is a membrane-bound enzyme which releases the endocannabinoid anandamide and other bioactive N-acylethanolamines from their corresponding NAPEs in animal tissues. NAPE-PLD has been shown to be expressed by specific populations of neurons in the brain and targeted to axonal processes. Recent studies have suggested that NAEs generated by NAPE-PLD in axons may act as anterograde synaptic signaling molecules that regulate the activity of postsynaptic neurons. NAPE-PLD has also been shown to catalyze the hydrolysis of NAPE to generate OEA (oleoylethanolamide), a natural lipid amide that inhibits food intake in free-feeding rodents by prolonging latency to feed and postmeal interval.

Specifications

Accession Number Q6IQ20
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 222236
Name Human NAPE PLD (aa 103-196) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A530089G06; C7orf18; DKFZp781D1098; FMP30; Mbldc1; Metallo-beta-lactamase domain containing 1; N-acyl phosphatidylethanolamine phospholipase D; N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D; NAPE-hydrolyzing phospholipase D; NAPEPLD; NAPE-PLD
Common Name NAPE PLD
Gene Symbol NAPEPLD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less