missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103330

Invitrogen™ Human DDB2 (aa 43-182) Control Fragment Recombinant Protein

Catalog No. RP103330
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103330 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103330 Supplier Invitrogen™ Supplier No. RP103330

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Damaged DNA binding protein (DDB) is a heterodimer composed of two subunits, p127 and p48, which are designated DDB1 and DDB2, respectively. The DDB heterodimer is involved in repairing DNA damaged by ultraviolet light. Specifically, DDB, also designated UV-damaged DNA binding protein (UV-DDB), xeroderma pigmentosum group E binding factor (XPE-BF) and hepatitis B virus X-associated protein 1 (XAP-1), binds to damaged cyclobutane pyrimidine dimers (CPDs). Mutations in the DDB2 gene are implicated as causes of xeroderma pigmentosum group E, an autosomal recessive disease in which patients are defective in nucleotide excision DNA repair. XPE is characterized by hypersensitivity of the skin to sunlight with a high frequency of skin cancer as well as neurologic abnormalities. The hepatitis B virus (HBV) X protein interacts with DDB1, which may mediate HBx transactivation.

Specifications

Accession Number Q92466
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1643
Name Human DDB2 (aa 43-182) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610043A19Rik; damage specific DNA binding protein 2; damage-specific DNA binding protein 2, 48 kDa; damage-specific DNA-binding protein 2; DDB p48 subunit; DDB2; DDBb; DNA damage-binding protein 2; UV-damaged DNA-binding protein 2; UV-DDB 2; UV-DDB2; xeroderma pigmentosum group E protein; XPE
Common Name DDB2
Gene Symbol DDB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less