missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102228

Invitrogen™ Human PEO1 (aa 143-277) Control Fragment Recombinant Protein

Catalog No. RP102228
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102228 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102228 Supplier Invitrogen™ Supplier No. RP102228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51715 (PA5-51715. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars.Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars (Spelbrink et al., 2001 [PubMed 11431692]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Specifications

Accession Number Q96RR1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56652
Name Human PEO1 (aa 143-277) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ataxin 8; Ataxin8; ATXN 8; ATXN8; C10 orf2; C10orf 2; C10orf2; C18H10orf2; C1H10orf2; C26H10orf2; C28H10orf2; chromosome 10 open reading frame 2; D19Ertd626e; fi04d09; FLJ21832; IOSCA; mitochondrial twinkle protein; MTDPS7; PEO; PEO 1; peo1; PEOA3; PRLTS5; progressive external ophthalmoplegia 1; progressive external ophthalmoplegia 1 (human); progressive external ophthalmoplegia 1 homolog; progressive external ophthalmoplegia 1 protein; Progressive external ophthalmoplegia 1 protein homolog; SANDO; SCA 8; SCA8; T7 gp4-like protein with intramitochondrial nucleoid localization; T7 helicase-related protein with intramitochondrial nucleoid localization; T7-like mitochondrial DNA helicase; twinkle; Twinkle mtDNA helicase; twinkle protein, mitochondrial; twinkle protein, mitochondrial-like; Twinkle protein, mitochondrial-like protein; Twinl; Twnk; wu:fi04d09
Common Name PEO1
Gene Symbol TWNK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less