missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107986

Invitrogen™ Human PHOX2B (aa 268-302) Control Fragment Recombinant Protein

Catalog No. RP107986
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107986 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107986 Supplier Invitrogen™ Supplier No. RP107986

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element.

Specifications

Accession Number Q99453
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8929
Name Human PHOX2B (aa 268-302) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dilated pupils 1; Dilp1; GENA 269; LOW QUALITY PROTEIN: paired mesoderm homeobox protein 2 B; NBLST2; NBPhox; neuroblastoma paired-type homeobox protein; neuroblastoma Phox; paired like homeobox 2 B; paired mesoderm homeobox 2 b; paired mesoderm homeobox protein 2 B; Paired-like homeobox 2 B; PHO x 2 B; PHO x 2 B homeodomain protein; Pm x 2 b
Common Name PHOX2B
Gene Symbol PHOX2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less