missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91108

Invitrogen™ Human FAM18B (aa 173-205) Control Fragment Recombinant Protein

Catalog No. RP91108
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91108 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91108 Supplier Invitrogen™ Supplier No. RP91108

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54030 (PA5-54030. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q9NYZ1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51030
Name Human FAM18B (aa 173-205) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CGI-148; FAM18B; FAM18B1; family with sequence similarity 18, member B; family with sequence similarity 18, member B1; Golgi apparatus membrane protein TVP23 homolog B; NPD008; protein FAM18B1; trans-golgi network vesicle protein 23 homolog B (S. cerevisiae); TVP23B; YDR084C
Common Name FAM18B
Gene Symbol TVP23B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less