missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SPAG4 (aa 191-279) Control Fragment Recombinant Protein

Catalog No. RP100903
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100903 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100903 Supplier Invitrogen™ Supplier No. RP100903

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61732 (PA5-61732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian sperm flagellum contains two cytoskeletal structures associated with the axoneme: the outer dense fibers surrounding the axoneme in the midpiece and principal piece and the fibrous sheath surrounding the outer dense fibers in the principal piece of the tail. Defects in these structures are associated with abnormal tail morphology, reduced sperm motility, and infertility. In the rat, the protein encoded by this gene associates with an outer dense fiber protein via a leucine zipper motif and localizes to the microtubules of the manchette and axoneme during sperm tail development.

Specifications

Accession Number Q9NPE6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6676
Name Human SPAG4 (aa 191-279) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700041K21Rik; acrosomal protein ACR55; cancer/testis antigen 127; CT127; mKIAA4118; MNCb-0953; outer dense fiber-associated protein SPAG4; Sad1 and UNC84 domain containing 4; SPAG4; sperm antigen 4; sperm associated antigen 4; sperm tail protein; sperm-associated antigen 4 protein; SUN domain-containing protein 4; SUN4
Common Name SPAG4
Gene Symbol SPAG4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less