missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SPAG4 (aa 191-279) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100903
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61732 (PA5-61732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The mammalian sperm flagellum contains two cytoskeletal structures associated with the axoneme: the outer dense fibers surrounding the axoneme in the midpiece and principal piece and the fibrous sheath surrounding the outer dense fibers in the principal piece of the tail. Defects in these structures are associated with abnormal tail morphology, reduced sperm motility, and infertility. In the rat, the protein encoded by this gene associates with an outer dense fiber protein via a leucine zipper motif and localizes to the microtubules of the manchette and axoneme during sperm tail development.Specifications
| Q9NPE6 | |
| Blocking Assay, Control | |
| 6676 | |
| 100 μL | |
| 1700041K21Rik; acrosomal protein ACR55; cancer/testis antigen 127; CT127; mKIAA4118; MNCb-0953; outer dense fiber-associated protein SPAG4; Sad1 and UNC84 domain containing 4; SPAG4; sperm antigen 4; sperm associated antigen 4; sperm tail protein; sperm-associated antigen 4 protein; SUN domain-containing protein 4; SUN4 | |
| SPAG4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SPAG4 (aa 191-279) Control Fragment | |
| RUO | |
| SPAG4 | |
| Unconjugated | |
| Recombinant | |
| PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |