missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101064

Invitrogen™ Human SERPINB7 (aa 203-334) Control Fragment Recombinant Protein

Catalog No. RP101064
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101064 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101064 Supplier Invitrogen™ Supplier No. RP101064

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55011 (PA5-55011. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Megsin, also designated SerpinB7 and TP55, is a 380 amino acid cytoplasmic protein that is predominantly expressed in mesangial cells, which play an important role in maintaining glomerular structure and function. As a member of the serpin family, megsin is a serine protesase inhibitor which potentially inactivate MMP-2, MMP-9 and plasmin, proteins that are notably responsible for degradation of extracellular matrix. Overexpression of megsin results in an increase in number of mesangial cells and therefore a progressive mesangial matrix expansion, which is accompanied by immune complex deposition. This finding suggests that megsin significantly influences the role of mesangial cells in renal structure and is likely implicated in a variety of nephropathies.

Specifications

Accession Number O75635
Concentration 0.5 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8710
Name Human SERPINB7 (aa 203-334) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4631416M05Rik; MEGSIN; mesangium predominant gene, megsin; ovalbumin; PPKN; serine (or cysteine) peptidase inhibitor, clade B, member 7; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 7; serine (or cysteine) proteinase inhibitor, clade B, member 7; serpin B7; serpin family B member 7; serpin peptidase inhibitor, clade B (ovalbumin), member 7; SERPINB7; Serpin-B7; TP55
Common Name SERPINB7
Gene Symbol SERPINB7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYIEVTEEGT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less