Learn More
Invitrogen™ Human ZNF709 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100579
Description
Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65412 (PA5-65412, PA5-62744 (PA5-62744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZNF709 may be involved in transcriptional regulation- Environmental benefits include:
- Recycled Content
- Ozone-Safe or Safe for the Ozone Layer
Specifications
Q8N972 | |
Blocking Assay, Control | |
163051 | |
100 ÎĽL | |
FLJ38281; Zinc finger protein 709; ZNF709 | |
ZNF709 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZNF709 Control Fragment | |
RUO | |
ZNF709 | |
Unconjugated | |
Recombinant | |
LQSLSAVTSSDQRRRSKEARTPGTRDTDSVVFED | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |