Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (18)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (34,002)
For Use With (Application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,026)
- (3)
- (2)
- (7)
- (21,447)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,401)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,393)
- (175)
- (8)
- (1)
- (31)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,030)
- (160)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,226)
- (1)
- (18)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (191)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,735)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (2,099)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (33,170)
Form
- (1)
- (23,202)
- (5,076)
- (29)
- (146)
- (26)
- (35)
Species
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (353)
- (1)
- (1)
- (1)
- (25,999)
- (1)
- (1)
- (4)
- (1)
- (558)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (95)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
30,647
results
1
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | Importin 7 |
| Gene Symbol | Ipo7 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY |
| Concentration | 0.5 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human Importin 7 (aa 874-959) Control Fragment |
| Accession Number | O95373 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | A330055O14Rik; C330016G14; FLJ14581; Imp7; importin 7; importin-7; IPO7; MGC138673; RAN binding protein 7; RAN-binding protein 7; RanBP7 |
| Product Type | Protein |
| Gene ID (Entrez) | 10527 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
2
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | CD22 |
| Gene Symbol | CD22 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE |
| Concentration | 2.6 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human CD22 (aa 450-538) Control Fragment |
| Accession Number | P20273 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | A530093D23; B-cell receptor CD22; BL-CAM; B-lymphocyte cell adhesion molecule; B-lymphocyte cell adhesion molecule (BL-CAM); Cd22; CD22 antigen; CD22 molecule; FLJ22814; Lectin 2; Leu-14; Lyb8; Lyb-8; MGC130020; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; Sialic acid-binding Ig-like lectin 2 (Siglec-2); Siglec2; Siglec-2; T-cell surface antigen Leu-14 |
| Product Type | Protein |
| Gene ID (Entrez) | 933 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
3
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | PLEKHG7 |
| Gene Symbol | PLEKHG7 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human PLEKHG7 (aa 594-679) Control Fragment |
| Accession Number | Q6ZR37 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | PH domain-containing family G member 7; pleckstrin homology and RhoGEF domain containing G7; pleckstrin homology domain containing, family G (with RhoGef domain) member 7; pleckstrin homology domain-containing family G member 7; PLEKHG7 |
| Product Type | Protein |
| Gene ID (Entrez) | 440107 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
4
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | AP000322.53 |
| Gene Symbol | SMIM34 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human AP000322.53 Control Fragment |
| Accession Number | A8MWV9 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Product Type | Protein |
| Gene ID (Entrez) | 388820 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
5
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | CT83 |
| Gene Symbol | CT83 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Concentration | 4.2 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human CT83 (aa 25-113) Control Fragment |
| Accession Number | Q5H943 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | Cancer/testis antigen 83; CT83; CXorf61; kita-kyushu lung cancer antigen 1; KKLC1; KK-LC-1 |
| Product Type | Protein |
| Gene ID (Entrez) | 203413 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
6
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | FAM55D |
| Gene Symbol | NXPE4 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE |
| Concentration | 1 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human FAM55D (aa 267-339) Control Fragment |
| Accession Number | Q6UWF7 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | C11orf33; C130036J11; D930028F11Rik; Fam55b; Fam55d; family with sequence similarity 55, member B; family with sequence similarity 55, member D; hypothetical protein LOC244853; hypothetical protein LOC515648; LOC100731209; neurexophilin and PC-esterase domain family member 4; neurexophilin and PC-esterase domain family, member 4; NXPE family member 4; Nxpe4; Protein FAM55D; UNQ3018/PRO9799 |
| Product Type | Protein |
| Gene ID (Entrez) | 54827 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
7
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | RPL13A |
| Gene Symbol | RPL13A |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV |
| Concentration | 5.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human RPL13A (aa 142-185) Control Fragment |
| Accession Number | P40429 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 1810026N22Rik; 23 kDa highly basic protein; 60S ribosomal protein L13a; L13A; Large ribosomal subunit protein uL13; P198; ribosomal protein L13a; Rpl13a; tissue specific transplantation antigen 1; tissue specific transplantation antigen P198-7; transplantation antigen P198; TSTA1; Tstap198-7; tum-antigen; Tum-P198 antigen; tum-transplantation antigen P198 |
| Product Type | Protein |
| Gene ID (Entrez) | 23521 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
8
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | P-Selectin (CD62P) |
| Gene Symbol | SELP |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT |
| Concentration | 1.7 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human P-Selectin (aa 382-522) Control Fragment |
| Accession Number | P16109 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140kDa, antigen CD62); selectin, platelet; Selp |
| Product Type | Protein |
| Gene ID (Entrez) | 6403 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
9
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | ERV3 |
| Gene Symbol | ERV3-1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA |
| Concentration | 4 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human ERV3 (aa 278-407) Control Fragment |
| Accession Number | Q14264 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | endogenous retroviral sequence 3; endogenous retrovirus group 3 member 1; endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3, member 1; Envelope polyprotein; envR; ERV3; ERV3 envelope protein; ERV-3 envelope protein; ERV3-1; ERV3-1 envelope protein; ERVR; ERV-R; ERV-R envelope protein; HERVR; HERV-R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; SU; Surface protein; TM; Transmembrane protein |
| Product Type | Protein |
| Gene ID (Entrez) | 2086 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
10
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | TREH |
| Gene Symbol | TREH |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK |
| Concentration | 2.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human TREH (aa 47-141) Control Fragment |
| Accession Number | O43280 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 2210412M19Rik; Alpha,alpha-trehalase; alpha,alpha-trehalose glucohydrolase; LOW QUALITY PROTEIN: trehalase; trehalase; si:ch211-147p17.2; TRE; TREA; TREH; Trehalase; trehalase (brush-border membrane glycoprotein) |
| Product Type | Protein |
| Gene ID (Entrez) | 11181 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
11
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | SHIP2 |
| Gene Symbol | INPPL1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human SHIP2 (aa 94-180) Control Fragment |
| Accession Number | O15357 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 51C; 51C protein; ablSH3-binding protein; inositol polyphosphate phosphatase like 1; inositol polyphosphate phosphatase-like 1; inositol polyphosphate phosphatase-like protein 1; Inppl1; INPPL-1; NS1; OPSMD; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2; protein 51C; PTP2C; SH2 domain-containing inositol 5'-phosphatase 2; SH2 domain-containing inositol phosphatase 2; SH2 domain-containing inositol-5'-phosphatase 2; SH2-containing inositol phosphatase 2; SHIP2; SHIP-2; SHP-2; SH-PTP2 |
| Product Type | Protein |
| Gene ID (Entrez) | 3636 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
12
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | NF-M |
| Gene Symbol | NEFM |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | KEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAESPVKEEAVAEVVTITKSVKVHLEKETKEEGKPLQQEKEKEKAGGEGGSEEEGSDKGAKG |
| Concentration | 3.90 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human NEFM (aa 702-794) Control Fragment |
| Accession Number | P07197 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 160 kDa neurofilament protein; major neuronal intermediate filament subunit; medium neurofilament subunit; middle molecular weight neurofilament protein NF-M(2); Nef3; Nefm; nef-m; nefm.S; nefm-a; nefm-b; Neurofilament 3; neurofilament 3 (150kDa medium); neurofilament 3, medium; neurofilament M subunit; neurofilament medium; neurofilament medium polypeptide; neurofilament medium S homeolog; neurofilament medium tail domain; neurofilament protein M; Neurofilament protein, middle polypeptide; neurofilament triplet M protein; neurofilament, medium polypeptide; neurofilament, medium polypeptide 150kDa; neurofilament, medium polypeptide S homeolog; neurofilament-3 (150 kD medium); neurofilament-M; neurofilament-M subunit; neuronal intermediate filament; NF160; NF165; NFM; NF-M; NF-M c-terminus; NF-M protein; NMC; XELAEV_18020229mg |
| Product Type | Protein |
| Gene ID (Entrez) | 4741 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
13
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | PDK1 |
| Gene Symbol | PDK1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human PDK1 (aa 92-151) Control Fragment |
| Accession Number | Q15118 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; B830012B01; D530020C15Rik; isoenzyme 1; kinase isoenzyme 1; lipoamide; mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1; PDH kinase 1; PDHK1; PDK p48; Pdk1; pyruvate dehydrogenase; pyruvate dehydrogenase kinase 1; Pyruvate dehydrogenase kinase isoform 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1 |
| Product Type | Protein |
| Gene ID (Entrez) | 5163 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
14
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | NAPSA |
| Gene Symbol | NAPSA |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF |
| Concentration | 2.5 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human NAPSA Control Fragment |
| Accession Number | O96009 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02 |
| Product Type | Protein |
| Gene ID (Entrez) | 9476 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
15
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | TOE1 |
| Gene Symbol | TOE1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS |
| Concentration | 4.1 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human TOE1 (aa 437-509) Control Fragment |
| Accession Number | Q96GM8 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 4930584N22Rik; 4933424D16Rik; AI413517; hCaf1z; Target of EGR1 protein 1; target of EGR1, member 1 (nuclear); TOE1 |
| Product Type | Protein |
| Gene ID (Entrez) | 114034 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |