Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,069)
- (3)
- (2)
- (7)
- (21,433)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (157)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,421)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,864)
- (175)
- (8)
- (1)
- (32)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,023)
- (159)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,095)
- (1)
- (157)
- (16)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (205)
- (2,860)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,736)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (3,149)
- (230)
- (1)
- (1)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (19)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (35,329)
Recombinant
- (69)
- (34,491)
Form
- (1)
- (23,070)
- (9,095)
- (29)
- (146)
- (26)
- (35)
Species
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (490)
- (1)
- (1)
- (1)
- (26,883)
- (1)
- (1)
- (22)
- (1)
- (837)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (123)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
32,047
results
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | FGF3 |
| Gene Symbol | FGF3 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS |
| Concentration | 1.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human FGF3 (aa 102-223) Control Fragment |
| Accession Number | P11487 |
| Purification Method | Purified |
| Gene Alias | FGF; fgf3; FGF-3; fgf3.L; fgf3-A; Fibroblast growth factor; Fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); fibroblast growth factor 3 L homeolog; Fibroblast growth factor-3; HBGF-3; Heparin-binding growth factor 3; id:ibd5006; INT2; int-2; INT-2 proto-oncogene protein; interacting gene 2; Int-P; lia; murine mammary tumor virus integration site 2, mouse; oncogene INT2; proto-oncogene Int-2; V-INT2 murine mammary tumor virus integration site oncogene homolog; XELAEV_18021863mg; xfgf3; xfgf-3 |
| Product Type | Protein |
| Gene ID (Entrez) | 2248 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QIEDLISRINDLQQAKKKSSEELRETHSLWEALHRELDS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SYCE1L (aa 47-85) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | KALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKERE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human MRPS26 (aa 94-156) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ASPH (aa 506-600) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human DTX1 (aa 361-407) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human RNF23 (aa 415-458) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRM |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human KLHL29 (aa 581-669) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TACC3 (aa 1-102) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TACC3 (aa 182-291) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | IYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human FAM110C (aa 102-152) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | CLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human RALGAPA2 (aa 1484-1587) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDED |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TFDP2 (aa 369-434) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MASAGGEDCESPAPEADRPHQRPFLIG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human UCK1 (aa 1-27) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NANOS3 (aa 13-84) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVN |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human VGAT (aa 166-207) Control Fragment |
| Recombinant | Recombinant |