Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1 – 15 of 24,391 results

Invitrogen™ Human IL-34 (Carrier-Free) Recombinant Protein, eBioscience™

Recombinant Protein

Pricing and Availability
Specifications

Purity or Quality Grade	Affinity chromatography
Conjugate	Unconjugated
Specific Reactivity	Human
Form	Lyophilized
pH Range	3.0
Common Name	Human IL-34 Carrier-Free
Molecular Weight (g/mol)	52.5kDa
Gene Symbol	IL34
Endotoxin Concentration	Less than 0.1ng/μg cytokine as determined by the LAL assay
Storage Requirements	-20°C
Protein Subtype	Recombinant
Name	Human IL-34 Carrier-Free
Accession Number	Q6ZMJ4
Regulatory Status	RUO
Purification Method	SDS-PAGE and HPLC
Product Type	Recombinant Protein, Carrier-Free
Biological Activity	The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells.
Gene ID (Entrez)	146433
Formulation	0.02M citric acid with no preservative; pH 3.0
Structural Form	HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag
Shelf Life	12 Months
Cross Reactivity	Hu
Species	Human (HEK293)
Recombinant	Recombinant

Invitrogen™ Cholera Toxin Subunit B (Recombinant), Biotin-XX Conjugate

Made from a recombinant version of the B subunit only to provide a very high-purity product that is completely free of the toxic A subunit

Pricing and Availability

Invitrogen™ Isolectin GS-IB₄ From Griffonia simplicifolia, biotin-XX Conjugate

Isolated from the seeds of Griffonia simplicifolia, a tropical African legume

Pricing and Availability

Invitrogen™ Human GIMAP1 (aa 185-252) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human GIMAP1 (aa 185-252) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human TTLL3 (aa 598-671) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human TTLL3 (aa 598-671) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human LINGO3 (aa 361-430) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human LINGO3 (aa 361-430) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human GPR41 (aa 286-343) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human GPR41 (aa 286-343) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human NAPSA (aa 238-268) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human NAPSA (aa 238-268) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human HLA-DOA (aa 75-124) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	GDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVE
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human HLA-DOA (aa 75-124) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human TAF1L (aa 1807-1826) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	PKQPFMLQHASGEHKDGHGK
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human TAF1L (aa 1807-1826) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human CDSN Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human CDSN Control Fragment
Recombinant	Recombinant

Invitrogen™ Human MGAM2 (aa 47-121) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human MGAM2 (aa 47-121) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human ALG3 (aa 69-122) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human ALG3 (aa 69-122) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human C6orf129 (aa 4-42) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	KKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELS
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human C6orf129 (aa 4-42) Control Fragment
Recombinant	Recombinant

Invitrogen™ Human FBXL20 (aa 1-26) Control Fragment Recombinant Protein

Recombinant Protein

Pricing and Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	MRRDVNGVTKSRFEMFSNSDEAVINK
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human FBXL20 (aa 1-26) Control Fragment
Recombinant	Recombinant

Prev
1
2
3
4
5
6
...
1,627
Next

Recombinant Proteins

Narrow Results

Filtered Search Results