Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (23,208)
- (5,051)
- (29)
- (22)
- (26)
- (35)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (93)
- (789)
- (3)
- (21,468)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (5)
- (10)
- (22,403)
- (1)
- (2)
- (1)
- (1)
- (1,810)
- (181)
- (1)
- (14)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (7)
- (3,998)
- (134)
- (1)
- (1)
- (4)
- (1)
- (20)
- (3)
- (21)
- (27)
- (5)
- (2)
- (13)
- (1)
- (1,227)
- (2)
- (18)
- (26)
- (1)
- (2)
- (1)
- (18)
- (2)
- (180)
- (1)
- (4)
- (1)
- (7)
- (1)
- (1)
- (3)
- (1)
- (1)
- (64)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (7)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (6)
- (1)
- (1,892)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (28,237)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (2)
- (1)
- (4)
- (8)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (27,953)
Species
- (2)
- (5)
- (29)
- (2)
- (1)
- (269)
- (23,144)
- (2)
- (1)
- (1)
- (116)
- (1)
- (6)
- (1)
- (1)
- (8)
- (12)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Keyword Search:
Clear search
1
–
15
of
24,485
results
| Regulatory Status | RUO |
|---|---|
| Preparation Method | Dilute alkaline solutions (1mg/mL) |
| Form | Solid |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C. |
| Species | Bovine |
| Recombinant | Native |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GDF11 (aa 239-293) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GHHEVDHFLREMPALIRMACVSTVAIE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human OR2W3 (aa 170-196) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SLC7A5 (aa 16-50) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human LIS1 (aa 16-161) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purification Method | Assay |
| Preparation Method | Dilute Alkaline Solutions (10mg/mL) |
| Purity or Quality Grade | ≥95% |
| Form | Solid |
| Without Additives | Carbohydrate and Fatty Acid Free |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared. |
| Species | Bovine |
| Recombinant | Native |