Learn More
Invitrogen™ Human ZNF630 (aa 8-112) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105680
Description
Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64875 (PA5-64875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in transcriptional regulation.- Environmental benefits include:
- Renewable Energy
Specifications
Q2M218 | |
Blocking Assay, Control | |
57232 | |
100 ÎĽL | |
dJ54B20.2; dJ54B20.2 (novel KRAB box containing C2H2 type zinc finger protein); zinc finger protein 630; ZNF630 | |
ZNF630 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZNF630 (aa 8-112) Control Fragment | |
RUO | |
ZNF630 | |
Unconjugated | |
Recombinant | |
VTFEDVAVDFTQEEWQQLNPAQKTLHRDVMLETYNHLVSVGCSGIKPDVIFKLEHGKDPWIIESELSRWIYPDRVKGLESSQQIISGELLFQREILERAPKDNSL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |