Learn More
Invitrogen™ Human ZNF432 (aa 149-201) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100010
Description
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111346 (PA5-111346, PA5-63830 (PA5-63830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZNF432 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF432 may be involved in transcriptional regulation.Specifications
O94892 | |
Blocking Assay, Control | |
9668 | |
100 ÎĽL | |
KIAA0798; Zinc finger protein 432; ZNF432 | |
ZNF432 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZNF432 (aa 149-201) Control Fragment | |
RUO | |
ZNF432 | |
Unconjugated | |
Recombinant | |
SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |