missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZBTB41 (aa 29-127) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94475
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57082 (PA5-57082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in transcriptional regulation.Greener Choice Claims
- Environmental benefits include:
- Renewable Energy
Specifications
| Q5SVQ8 | |
| Blocking Assay, Control | |
| 360023 | |
| 100 ÎĽL | |
| 8430415N23Rik; 9430031N01; 9830132G07Rik; AI316857; FRBZ1; FRBZ1 protein (FRBZ1); RGD1560834; RP11-469L3.1; Zbtb41; zinc finger and BTB domain containing 41; zinc finger and BTB domain containing 41 homolog; zinc finger and BTB domain-containing protein 41; ZNF924 | |
| ZBTB41 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZBTB41 (aa 29-127) Control Fragment | |
| RUO | |
| ZBTB41 | |
| Unconjugated | |
| Recombinant | |
| VECDQVTYTHSAGRPTPEALHCYQELPPSPDQRKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKNPSTDVVT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |