Learn More
Invitrogen™ Human TTC39C (aa 37-130) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105366
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66791 (PA5-66791. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TTC39C is a protein coding gene.Specifications
Q8N584 | |
Blocking Assay, Control | |
125488 | |
100 ÎĽL | |
C18orf17; HsT2697; tetratricopeptide repeat domain 39 C; tetratricopeptide repeat protein 39 C; TPR repeat protein 39 C; TTC39C | |
TTC39C | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TTC39C (aa 37-130) Control Fragment | |
RUO | |
TTC39C | |
Unconjugated | |
Recombinant | |
INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |