missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRIT1 (aa 266-356) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108769
Description
Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TRIT1 is responsible for the modification of A37 to isopentenyl A37 of both cytosolic and mitochondrial tRNAs.Greener Choice Claims
- Environmental benefits include:
- Renewable Energy
Specifications
| Q9H3H1 | |
| Blocking Assay, Control | |
| 54802 | |
| 100 ÎĽL | |
| 2310075G14Rik; AI314189; AI314635; AV099619; GRO1; hGRO1; IPP transferase; IPPT; IPT; IPTase; isopentenyl-diphosphate:tRNA isopentenyltransferase; MOD5; Trit1; tRNA dimethylallyltransferase; tRNA dimethylallyltransferase, mitochondrial; tRNA isopentenylpyrophosphate transferase; tRNA isopentenyltransferase; tRNA isopentenyltransferase 1; tRNA isopentenyltransferase, mitochondrial | |
| Trit1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TRIT1 (aa 266-356) Control Fragment | |
| RUO | |
| TRIT1 | |
| Unconjugated | |
| Recombinant | |
| KNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |