missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRIM46 (aa 492-594) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108210
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84260 (PA5-84260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Microtubule-associated protein that is involved in the formation of parallel microtubule bundles linked by cross-bridges in the proximal axon. Required for the uniform orientation and maintenance of the parallel microtubule fascicles, which are important for efficient cargo delivery and trafficking in axons. Thereby also required for proper axon specification, the establishment of neuronal polarity and proper neuronal migration. [UniProt]Greener Choice Claims
- Environmental benefits include:
- Source Reduction
Specifications
| Q7Z4K8 | |
| Blocking Assay, Control | |
| 80128 | |
| 100 ÎĽL | |
| Gene Y protein; geneY; TRIFIC; TRIM46; tripartite motif containing 46; tripartite motif protein 46; tripartite motif-containing 46; tripartite motif-containing protein 46; tripartite, fibronectin type III and C-terminal SPRY motif-containing; tripartite, fibronectin type-III and C-terminal SPRY motif protein | |
| TRIM46 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TRIM46 (aa 492-594) Control Fragment | |
| RUO | |
| TRIM46 | |
| Unconjugated | |
| Recombinant | |
| LLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |