missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TBCC (aa 93-168) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94798
Description
Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57143 (PA5-57143. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Tubulin-folding protein; involved in the final step of the tubulin folding pathway.Specifications
| Q15814 | |
| Blocking Assay, Control | |
| 6903 | |
| 100 ÎĽL | |
| 2810055C19Rik; CFC; EGK_14912; Tbcc; tubulin folding cofactor C; tubulin-folding cofactor C; Tubulin-specific chaperone C | |
| TBCC | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TBCC (aa 93-168) Control Fragment | |
| RUO | |
| TBCC | |
| Unconjugated | |
| Recombinant | |
| GLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPPAVESIQDS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |