missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SPATS2L (aa 352-438) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105390
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66836 (PA5-66836. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SPATS2L is a protein coding gene.Specifications
| Q9NUQ6 | |
| Blocking Assay, Control | |
| 26010 | |
| 100 ÎĽL | |
| 2810022L02Rik; A230104H11Rik; AA987173; AI480531; AI842453; AW413586; DNA polymerase transactivated protein 6; DNA polymerase-transactivated protein 6; DNAPTP6; RGD1309930; SGNP; SP1224; Spats2l; SPATS2-like protein; spermatogenesis associated serine rich 2 like; spermatogenesis associated, serine rich 2 like; spermatogenesis associated, serine-rich 2-like; stress granule and nucleolar protein | |
| SPATS2L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SPATS2L (aa 352-438) Control Fragment | |
| RUO | |
| SPATS2L | |
| Unconjugated | |
| Recombinant | |
| GEITHPKNNYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFN | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |