Learn More
Invitrogen™ Human SPATS2L (aa 352-438) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105390
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66836 (PA5-66836. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SPATS2L is a protein coding gene.- Environmental benefits include:
- Renewable Energy
- Recyclable
- Non-Toxic
Specifications
Q9NUQ6 | |
Blocking Assay, Control | |
26010 | |
100 ÎĽL | |
2810022L02Rik; A230104H11Rik; AA987173; AI480531; AI842453; AW413586; DNA polymerase transactivated protein 6; DNA polymerase-transactivated protein 6; DNAPTP6; RGD1309930; SGNP; SP1224; Spats2l; SPATS2-like protein; spermatogenesis associated serine rich 2 like; spermatogenesis associated, serine rich 2 like; spermatogenesis associated, serine-rich 2-like; stress granule and nucleolar protein | |
SPATS2L | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SPATS2L (aa 352-438) Control Fragment | |
RUO | |
SPATS2L | |
Unconjugated | |
Recombinant | |
GEITHPKNNYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |