Learn More
Invitrogen™ Human SETD1B (aa 808-877) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106936
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66255 (PA5-66255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Two distinct signaling pathways activate the host innate immunity against viral infection. One pathway is reliant on members of the Toll-like receptor (TLR) family while the other uses the RNA helicase RIG-I as a receptor for intracellular viral double-stranded RNA as a trigger for the immune response. VISA is a mitochondrial membrane protein that was identified as a critical component in the IFN-b signaling pathways that recruits IRF-3 to RIG-I, leading to its activation and that of NF-kappa-B. VISA is also thought to interact with other components of the innate immune pathway such as the TLR adapter protein TRIF, TRAF2 and TRAF6. VISA also interacts with the IKK-a, IKK-b and IKK-iota kinases through its C-terminal region. Cleavage of this region by the Hepatitis C virus (HCV) protease allows HCV to escape the host immune system. At least three isoforms of VISA are known to exist.- Environmental benefits include:
- Recyclable
Specifications
Q9UPS6 | |
Blocking Assay, Control | |
23067 | |
100 ÎĽL | |
AA516740; BC035291; Histone-lysine N-methyltransferase SETD1B; hSET1B; Kiaa1076; KMT2G; LOC100359816; Lysine N-methyltransferase 2 G; mKIAA1076; rCG21620-like; SET domain containing 1 B; SET domain-containing protein 1 B; SET1B; SETD1B | |
Setd1b | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SETD1B (aa 808-877) Control Fragment | |
RUO | |
SETD1B | |
Unconjugated | |
Recombinant | |
GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |