Learn More
Invitrogen™ Human SEMA4A (aa 299-386) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105376
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111608 (PA5-111608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.Specifications
Q9H3S1 | |
Blocking Assay, Control | |
64218 | |
100 ÎĽL | |
AI132332; CORD10; RP35; Sema B; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4 A; Sema4a; Semab; semaphorin 4 A; semaphorin B; semaphorin-4 A; Semaphorin-B; SemB; UNQ783/PRO1317 | |
SEMA4A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SEMA4A (aa 299-386) Control Fragment | |
RUO | |
SEMA4A | |
Unconjugated | |
Recombinant | |
LPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |