missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RS1 (aa 94-159) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106946
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66264 (PA5-66264. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be active in cell adhesion processes during retinal development.Greener Choice Claims
- Environmental benefits include:
- Free-of a substance that causes environmental harm
- Non-Toxic
- Ozone-Safe or Safe for the Ozone Layer
- Recyclable
- Recycled Content
- Renewable Energy
- Renewable Materials
Specifications
| O15537 | |
| Blocking Assay, Control | |
| 6247 | |
| 100 ÎĽL | |
| retinoschisin; retinoschisin 1; retinoschisis (X-linked, juvenile) 1 (human); retinoschisis 1 homolog; RS; RS1; Rs1h; tmgc1; X-linked juvenile retinoschisis protein; X-linked juvenile retinoschisis protein homolog; XLRS1 | |
| RS1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RS1 (aa 94-159) Control Fragment | |
| RUO | |
| RS1 | |
| Unconjugated | |
| Recombinant | |
| SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |