Learn More
Invitrogen™ Human PRSS38 (aa 177-245) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94509
Description
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55748 (PA5-55748. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein remains unknown.- Environmental benefits include:
- Free-of a substance that causes environmental harm
- Non-Toxic
- Renewable Energy
- Ozone-Safe or Safe for the Ozone Layer
Specifications
A1L453 | |
Blocking Assay, Control | |
339501 | |
100 ÎĽL | |
marapsin 2; marapsin-2; MPN2; protease, serine 38; protease, serine, 38; PRSS38; Serine protease 38; serine protease MPN2 | |
PRSS38 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PRSS38 (aa 177-245) Control Fragment | |
RUO | |
PRSS38 | |
Unconjugated | |
Recombinant | |
NLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |