missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PIP4K2A (aa 317-351) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105356
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PIP4K2A lipid kinase or phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, is a member of the phosphatidylinositol-5-phosphate 4-kinase family that catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-4,5-bisphosphate. PIP4K2A plays as essential role in the phosphoinositide signal transduction cascades as the precursor to second messengers and is involved in the regulation of secretion, cell proliferation, differentiation, and motility. PIP4K2A may be one of the factors related to the regulation of the beta-globin gene expression and the different levels of Hb H in alpha-thalassemic patients. Diseases associated with PIP4K2A include B-Lymphoblastic Leukemia/Lymphoma With Hyperdiploidy and Bipolar Disorder.Greener Choice Claims
- Environmental benefits include:
- Renewable Energy
Specifications
P48426 | |
Blocking Assay, Control | |
5305 | |
100 ÎĽL | |
1-phosphatidylinositol 5-phosphate 4-kinase 2-alpha; 1-phosphatidylinositol-4-phosphate kinase; 1-phosphatidylinositol-4-phosphate-5-kinase; 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha; 1-phosphatidylinositol-5-phosphate 4-kinase A; AW742916; diphosphoinositide kinase 2-alpha; Phosphatidylinositol 5-phosphate 4-kinase type II alpha; phosphatidylinositol 5-phosphate 4-kinase type-2 alpha; phosphatidylinositol-4-phosphate 5-kinase, type II, alpha; phosphatidylinositol-5-phosphate 4-kinase type 2 alpha; phosphatidylinositol-5-phosphate 4-kinase type-2 alpha; phosphatidylinositol-5-phosphate 4-kinase, type II, alpha; PI(5)P 4-kinase type II alpha; PI5P4KA; Pip4k2a; PIP4KII-alpha; PIP5K2; Pip5k2a; PIP5KIIA; PIP5KIIalpha; PIP5KII-alpha; PIP5KIII; PIPK; PIPK2 alpha; PtdIns(4)P-5-kinase B isoform; PtdIns(4)P-5-kinase C isoform; ptdIns(5)P-4-kinase isoform 2-alpha; type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform | |
PIP4K2A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PIP4K2A (aa 317-351) Control Fragment | |
RUO | |
PIP4K2A | |
Unconjugated | |
Recombinant | |
PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |