Learn More
Invitrogen™ Human PIN4 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100594
Description
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62973 (PA5-62973. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling.Specifications
Q9Y237 | |
Blocking Assay, Control | |
5303 | |
100 ÎĽL | |
2410002I22Rik; EPVH; eukaryotic parvulin homolog; hEPVH; hPar14; hPar17; MGC138486; Par14; Par17; parvulin; parvulin-14; Parvulin-17; peptidyl-prolyl cis/trans isomerase EPVH; peptidylprolyl cis/trans isomerase NIMA-interacting, 4; peptidylprolyl cis/trans isomerase, NIMA-interacting 4; peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; Peptidyl-prolyl cis-trans isomerase Pin4; PIN4; PPIase Pin4; protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); rotamase PIN4 | |
Pin4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PIN4 Control Fragment | |
RUO | |
PIN4 | |
Unconjugated | |
Recombinant | |
GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |