Learn More
Invitrogen™ Human MAGEF1 (aa 1-59) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100247
Description
Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61368 (PA5-61368. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Melanoma-associated antigen (MAGE) are completely silent in normal tissues, with the exception of male germ cells, and, for some of them, placenta. These antigens ought to be strictly tumor specific, expressed in tumor cells of various histological types. Because of their specific expression on tumor cells, these antigens are of particular interest for antitumor immunotherapy. Genes of the MAGE family direct the expression of tumor antigens that are recognized on a human melanoma by autologous cytolytic T lymphocytes. Though the function of MAGE is unknown, may play a role in embryonal development and tumor transformation or aspects of tumor progression.Specifications
Q9HAY2 | |
Blocking Assay, Control | |
64110 | |
100 ÎĽL | |
6430590I03Rik; MAGE family member F1; MAGEF1; MAGE-F1; MAGE-F1 antigen; MAGF1; melanoma antigen family F, 1; melanoma antigen family F1; melanoma-associated antigen F1; MGC19617 | |
MAGEF1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MAGEF1 (aa 1-59) Control Fragment | |
RUO | |
MAGEF1 | |
Unconjugated | |
Recombinant | |
MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |