Learn More
Invitrogen™ Human LCE6A (aa 1-80) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100569
Description
Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61230 (PA5-61230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
- Environmental benefits include:
- Renewable Energy
Specifications
A0A183 | |
Blocking Assay, Control | |
448835 | |
100 ÎĽL | |
C1orf44; late cornified envelope 6 A; late cornified envelope protein 6 A; LCE6A | |
LCE6A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LCE6A (aa 1-80) Control Fragment | |
RUO | |
LCE6A | |
Unconjugated | |
Recombinant | |
MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |