Learn More
Invitrogen™ Human LCAT (aa 133-214) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100005
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83739 (PA5-83739. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.- Environmental benefits include:
- Renewable Energy
Specifications
P04180 | |
Blocking Assay, Control | |
3931 | |
100 ÎĽL | |
AI046659; D8Wsu61e; Lcat; lecithin cholesterol acyltransferase; lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; phosphatidylcholine-sterol acyltransferase; phosphatidylcholine--sterol O-acyltransferase; Phospholipid-cholesterol acyltransferase; testicular secretory protein Li 24 | |
LCAT | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LCAT (aa 133-214) Control Fragment | |
RUO | |
LCAT | |
Unconjugated | |
Recombinant | |
VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |