missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human KLHL30 (aa 390-461) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107130
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66457 (PA5-66457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
KLHL30 is a protein coding gene.Specifications
| Q0D2K2 | |
| Blocking Assay, Control | |
| 377007 | |
| 100 ÎĽL | |
| kelch like family member 30; kelch-like 30; kelch-like family member 30; kelch-like protein 30; KLHL30 | |
| KLHL30 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human KLHL30 (aa 390-461) Control Fragment | |
| RUO | |
| KLHL30 | |
| Unconjugated | |
| Recombinant | |
| VEVESYDPYTDSWTPVSPALKYVSNFSAAGCRGRLYLVGSSACKYNALALQCYNPVTDAWSVIASPFLPKYL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |