missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HMGB4 (aa 96-173) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94470
Description
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57370 (PA5-57370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.Specifications
| Q8WW32 | |
| Blocking Assay, Control | |
| 127540 | |
| 100 ÎĽL | |
| 1700001F22Rik; AI326135; dJ1007G16.5; high mobility group box 4; high mobility group protein B4; high-mobility group box 4; HMG2 like; Hmgb4; LOC539195 protein | |
| HMGB4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human HMGB4 (aa 96-173) Control Fragment | |
| RUO | |
| HMGB4 | |
| Unconjugated | |
| Recombinant | |
| PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |