Learn More
Invitrogen™ Human HINT3 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94657
Description
Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55729 (PA5-55729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. Hydrolyzes phosphoramidate and acyl-adenylate substrates.- Environmental benefits include:
- Renewable Energy
Specifications
Q9NQE9 | |
Blocking Assay, Control | |
135114 | |
100 ÎĽL | |
HINT3; HINT-3; HINT4; histidine triad nucleotide binding protein 3; histidine triad nucleotide-binding protein 3; HIT-like protein | |
HINT3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human HINT3 Control Fragment | |
RUO | |
HINT3 | |
Unconjugated | |
Recombinant | |
MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |