Learn More
Invitrogen™ Human HADHB (aa 11-101) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105381
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84707 (PA5-84707. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Mutations in this gene result in trifunctional protein deficiency. Alternatively spliced transcript variants encoding different isoforms have been described.- Environmental benefits include:
- Source Reduction
Specifications
P55084 | |
Blocking Assay, Control | |
3032 | |
100 ÎĽL | |
2-enoyl-Coenzyme A (CoA) hydratase, beta subunit; 3-ketoacyl-CoA thiolase; 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, beta subunit; 4930479F15Rik; acetyl-CoA acyltransferase; bet; Beta-ketothiolase; ECHB; HADHB; hydroxyacyl-Co; hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta aubunit; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit; mitochondrial trifunctional protein, beta subunit; MSTP029; MTPB; TP-BETA; trifunctional enzyme subunit beta, mitochondrial | |
HADHB | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human HADHB (aa 11-101) Control Fragment | |
RUO | |
HADHB | |
Unconjugated | |
Recombinant | |
LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |