missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GC (aa 266-409) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100501
Description
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GC (vitamin D-binding protein) is involved in vitamin D transport/storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.Specifications
| P02774 | |
| Blocking Assay, Control | |
| 2638 | |
| 100 ÎĽL | |
| DBP; DBP/ VDBG; DBP/GC; DBP02; DBP-maf; epididymis secretory protein Li 51; Gc; Gc globulin; Gc protein-derived macrophage activating factor; GC, vitamin D binding protein; gc-globulin; GcMAF; Gc-MAF; GRD3; group specific component; Group specific component vitamin D binding protein; Group-specific component; group-specific component (vitamin D binding protein); hDBP; HEL-S-51; V VDB; VDB; VDBG; Vdbp; Vitamin D binding alpha globulin; vitamin D-binding alpha-globulin; vitamin D-binding protein; Vitamin D-binding protein-macrophage activating factor | |
| GC | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GC (aa 266-409) Control Fragment | |
| RUO | |
| GC | |
| Unconjugated | |
| Recombinant | |
| CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |