missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FSTL3 (aa 27-101) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100061
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60983 (PA5-60983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis.Greener Choice Claims
- Environmental benefits include:
- Recyclable
Specifications
| O95633 | |
| Blocking Assay, Control | |
| 10272 | |
| 100 ÎĽL | |
| E030038F23Rik; FLRG; FLRGFSRP; follistatin like 3; follistatin-like 3; follistatin-like 3 (secreted glycoprotein); follistatin-like protein 3; Follistatin-related gene protein; follistatin-related protein 3; FSRP; FSTL3; UNQ674/PRO1308 | |
| FSTL3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| 4.20 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FSTL3 (aa 27-101) Control Fragment | |
| RUO | |
| FSTL3 | |
| Unconjugated | |
| Recombinant | |
| MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |