missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FAM195B (aa 37-97) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100674
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61029 (PA5-61029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Greener Choice Claims
- Environmental benefits include:
- Recyclable
Specifications
| C9JLW8 | |
| Blocking Assay, Control | |
| 348262 | |
| 100 ÎĽL | |
| FAM195B; family with sequence similarity 195 member B; family with sequence similarity 195, member B; GRAN2; Granulin-2; MAPK regulated corepressor interacting protein 1; MAPK regulated co-repressor interacting protein 1; MAPK-regulated co-repressor interacting protein 1; mapk-regulated corepressor-interacting protein 1; MCRIP; MCRIP1; MCRIP1 protein; protein FAM195B | |
| MCRIP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FAM195B (aa 37-97) Control Fragment | |
| RUO | |
| FAM195B | |
| Unconjugated | |
| Recombinant | |
| VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |