missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ELF4 (aa 331-409) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101163
Description
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63593 (PA5-63593. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ELF4 is transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. The protein acts synergistically with RUNX1 to transactivate the IL3 promoter. Also transactivates the PRF1 promoter in natural killer (NK) cells. This protein plays a role in the development and function of NK and NK T-cells and in innate immunity.Specifications
| Q99607 | |
| Blocking Assay, Control | |
| 2000 | |
| 100 ÎĽL | |
| AV314029; BC042423; E74 like ETS transcription factor 4; E74-like factor 4; E74-like factor 4 (ets domain transcription factor); E74-like factor 4; myeloid elf-1-like factor; myeloid elf-1 like factor; ELF4; ELFR; ENSMUSG00000053512; ETS-related transcription factor Elf-4; Gm9907; MEF; myeloid elf-1 like factor; myeloid Elf-1-like factor; RGD1560743 | |
| Elf4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ELF4 (aa 331-409) Control Fragment | |
| RUO | |
| ELF4 | |
| Unconjugated | |
| Recombinant | |
| SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |