missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DSCC1 (aa 298-391) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93796
Alert:
This chemical may require us to obtain additional information for our regulatory and chemical compliance records. If required, we will contact you for this information once your order is placed.
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54885 (PA5-54885. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 arecomponents of an alternative replication factor C (RFC) (see MIM600404) complex that loads PCNA (MIM 176740) onto DNA during Sphase of the cell cycle.Greener Choice Claims
- Environmental benefits include:
- Recyclable
Specifications
| Q9BVC3 | |
| Blocking Assay, Control | |
| 79075 | |
| 100 ÎĽL | |
| 2010006I05Rik; 2600005O03Rik; DCC1; defective in sister chromatid cohesion 1 homolog; defective in sister chromatid cohesion 1 homolog (S. cerevisiae); defective in sister chromatid cohesion protein 1 homolog; DNA replication and sister chromatid cohesion 1; DSCC1; RGD1561749; Sister chromatid cohesion protein DCC1; UNQ9337/PRO34008 | |
| DSCC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DSCC1 (aa 298-391) Control Fragment | |
| RUO | |
| DSCC1 | |
| Unconjugated | |
| Recombinant | |
| EGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |