Learn More
Invitrogen™ Human CWC27 (aa 71-159) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105371
Description
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84702 (PA5-84702. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
As part of the spliceosome, plays a role in pre-mRNA splicing (PubMed:29360106). Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity (PubMed:20676357). [UniProt]Specifications
Q6UX04 | |
Blocking Assay, Control | |
10283 | |
100 ÎĽL | |
3110009E13Rik; Antigen NY-CO-10; CWC27; CWC27 spliceosome associated protein homolog; CWC27 spliceosome-associated protein homolog; CWC27 spliceosome-associated protein homolog (S. cerevisiae); NY-CO-10; peptidyl-prolyl cis-trans isomerase CWC27 homolog; peptidyl-prolyl cis-trans isomerase SDCCAG10; PPIase CWC27; PPIase SDCCAG10; Probable inactive peptidyl-prolyl cis-trans isomerase CWC27 homolog; SDCCAG10; SDCCAG-10; Serologically defined colon cancer antigen 10; Spliceosome-associated protein CWC27 homolog; UNQ438/PRO871 | |
Cwc27 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CWC27 (aa 71-159) Control Fragment | |
RUO | |
CWC27 | |
Unconjugated | |
Recombinant | |
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |