missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CNPY2 (aa 21-128) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP97779
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58403 (PA5-58403. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CNPY2 is positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.Greener Choice Claims
- Environmental benefits include:
- Renewable Energy
Specifications
| Q9Y2B0 | |
| Blocking Assay, Control | |
| 10330 | |
| 100 ÎĽL | |
| 5330432A10Rik; AW229003; canopy 2 homolog; canopy 2 homolog (zebrafish); canopy FGF signaling regulator 2; Cnpy2; D10Bwg1546e; HP10390; MIR-interacting saposin-like protein; MSAP; Protein canopy homolog 2; putative secreted protein Zsig9; Tmem4; transmembrane protein 4; UNQ1943/PRO4426; Zsig9 | |
| CNPY2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CNPY2 (aa 21-128) Control Fragment | |
| RUO | |
| CNPY2 | |
| Unconjugated | |
| Recombinant | |
| RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |