missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDKN2AIP (aa 82-160) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107135
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66460 (PA5-66460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.Specifications
| Q9NXV6 | |
| Blocking Assay, Control | |
| 55602 | |
| 100 ÎĽL | |
| 4921511I16Rik; AW208986; CARF; CDKN2A interacting protein; CDKN2A-interacting protein; CDKN2A-interacting protein-like protein; Cdkn2aip; CDKN2AIP-like protein; collaborates/cooperates with ARF (alternate reading frame) protein; collaborator of ARF; MGC137334 protein; RGD1305302 | |
| Cdkn2aip | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CDKN2AIP (aa 82-160) Control Fragment | |
| RUO | |
| CDKN2AIP | |
| Unconjugated | |
| Recombinant | |
| WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |