missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CADM3 (aa 84-225) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94790
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82047 (PA5-82047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
IGSF4B is a brain-specific protein related to the calcium-independent cell-cell adhesion molecules known as nectins.Specifications
| Q8N126 | |
| Blocking Assay, Control | |
| 57863 | |
| 100 ÎĽL | |
| BIgR; brain immunoglobulin receptor; CADM3; Cell adhesion molecule 3; dendritic cell nectin-like protein 1 short isoform; IGSF4B; Immunoglobulin superfamily member 4 B; immunoglobulin superfamily, member 4 B; NECL1; NECL-1; nectin-like 1; nectin-like protein 1; nectin-lke 1; synaptic cell adhesion molecule 3; SYNCAM3; TSLC1-like 1; TSLC1-like protein 1; TSLL1; UNQ225/PRO258 | |
| Cadm3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CADM3 (aa 84-225) Control Fragment | |
| RUO | |
| CADM3 | |
| Unconjugated | |
| Recombinant | |
| QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |