Learn More
Invitrogen™ Human BMS1 (aa 711-805) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP102935
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60230 (PA5-60230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
BMS1 (Ribosome biogenesis protein BMS1 homolog) is a 1,282 amino acid protein encoded by the human gene BMS1. BMS1 is a nuclear protein that belongs to the BMS1/TSR1 family (BMS1 subfamily). BMS1 is believed to act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus. The 40S ribosomal subunit is an important member of the 80S ribosome complex, which also includes initiator tRNA and a 60S ribosomal subunit. The 80S ribosome is assembled by eukaryotic initiation factors (eIFs) at the initiation codon of mRNA in order to begin translation initiation. The joining of these ribosomal subunits requires eIF5B.- Environmental benefits include:
- Source Reduction
Specifications
Q14692 | |
Blocking Assay, Control | |
9790 | |
100 ÎĽL | |
AA408648; ACC; AU020092; AU043373; BB007109; BC030906; BMS1; BMS1 homolog, ribosome assembly protein; BMS1 homolog, ribosome assembly protein (yeast); BMS1 ribosome biogenesis factor; BMS1, ribosome biogenesis factor; Bms1l; BMS1-like, ribosome assembly protein; KIAA0187; mKIAA0187; ribosome assembly protein BMS1 homolog; Ribosome biogenesis protein BMS1 homolog | |
Bms1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human BMS1 (aa 711-805) Control Fragment | |
RUO | |
BMS1 | |
Unconjugated | |
Recombinant | |
ELGGLFRVNQPDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELYGDFEDLETGDVHKGKSGPNTQNEDI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |