Learn More
Invitrogen™ Human ASB13 (aa 191-267) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107091
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66419 (PA5-66419. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length sequences are not known.Specifications
Q8WXK3 | |
Blocking Assay, Control | |
79754 | |
100 μL | |
2210015B19Rik; 6430573K02Rik; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; ankyrin repeat and SOCS box-containing 13; ankyrin repeat and SOCS box-containing protein 13; ankyrin repeat domain-containing SOCS box protein 13; ankyrin repeat domain-containing SOCS box protein Asb-13; ASB13; Asb-13; C85285 | |
ASB13 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ASB13 (aa 191-267) Control Fragment | |
RUO | |
ASB13 | |
Unconjugated | |
Recombinant | |
KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |