Learn More
Invitrogen™ Human ANAPC2 (aa 150-234) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105397
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84731 (PA5-84731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits.Specifications
Q9UJX6 | |
Blocking Assay, Control | |
29882 | |
100 ÎĽL | |
9230107K09Rik; AL024279; Anapc2; anaphase promoting complex subunit 2; anaphase-promoting complex subunit 2; Apc2; cyclosome subunit 2; Emi4; expressed during mesenchymal induction 4; Imi4; induced during mesenchymal induction 4; KIAA1406; mKIAA1406 | |
ANAPC2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ANAPC2 (aa 150-234) Control Fragment | |
RUO | |
ANAPC2 | |
Unconjugated | |
Recombinant | |
REEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |