missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human 3BP5L (aa 201-300) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94464
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58233 (PA5-58233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Specifications
| Q7L8J4 | |
| Blocking Assay, Control | |
| 80851 | |
| 100 ÎĽL | |
| KIAA1720; SH3 binding domain protein 5 like; SH3 domain-binding protein 5-like; SH3-binding domain protein 5 like; SH3-binding domain protein 5-like; SH3BP5L; SH3BP-5-like; UNQ2766/PRO7133 | |
| SH3BP5L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human 3 BP5L (aa 201-300) Control Fragment | |
| RUO | |
| 3 BP5L | |
| Unconjugated | |
| Recombinant | |
| CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |