missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

runt-related transcription factor 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RUNX3 protein.

Supplier:  Abnova Corporation H00000864B01

Catalog No. 89-005-045



Description

Description

This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Specifications

Specifications

runt-related transcription factor 3
Polyclonal
Mouse polyclonal antibody raised against a full-length human RUNX3 protein.
RUNX3
AML2/CBFA3/FLJ34510/MGC16070/PEBP2aC
Mouse
50 μL
Yes
864
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
No additive
NM_001031680.2
RUNX3
RUNX3 (AAH13362.1, 1 a.a. ∼ 429 a.a) full-length human protein.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions