Learn More
CLK3 (M07A), Mouse anti-Human, Clone: 7D6, Abnova™
Mouse monoclonal antibody raised against a partial recombinant CLK3.
Supplier: Abnova Corporation H00001198M07A
Description
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq
Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV- Environmental benefits include:
- Recyclable
Specifications
CLK3 | |
Monoclonal | |
Unconjugated | |
ascites with no preservative | |
BC002555 | |
CLK3 | |
CLK3 (AAH02555, 36 a.a. ∼ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
RUO | |
1198 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Ascites |
ELISA, Western Blot | |
7D6 | |
Mouse monoclonal antibody raised against a partial recombinant CLK3. | |
CLK3 | |
FLJ22858/PHCLK3/PHCLK3/152 | |
Mouse | |
200 μL | |
Primary | |
Human | |
Antibody | |
IgG2b κ |