missing translation for 'onlineSavingsMsg'
Learn More

ATP6V1A, Mouse, Clone: 4F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATP6V1A.

Supplier:  Abnova Corporation H00000523M02

Catalog No. 89-016-279


Only null left
Explore available promotions

Description

Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c″, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq]

Sequence: TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED
Greener Choice Claims
  • Environmental benefits include:
    • Recyclable
Specifications
Show More
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Promotions

Promotions